Scaffold Ga0188871_1004341

Overview

Basic Information

• Taxon OID: 3300019113
• Scaffold ID: Ga0188871_1004341
• Source Dataset Name: Metatranscriptome of marine microbial communities from Baltic Sea - GS845_ls3
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 802
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae → Gonyaulacales → Pyrocystaceae → Alexandrium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location

• Location Name: Baltic Sea
• Coordinates
  • Lat. (^o): 54.570232
  • Long. (^o): 11.332183
  • Depth (m): .3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F008933	Metatranscriptome	325	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0188871_10043411	F008933	N/A	GIQNLFETRLGEKGLGLKELAILASTLEHLVHVEALQRLNVSYVAKSYSQEDVLSEEEAMNVLDMYMSIYILGFMHSNLTTMTANQAQKLHANILEFYPTYPETQQFMKEVYKSVAPKRDYVYFNEVENVIAEIGERYGRFQDIECRQFKDWLLTVEDTSVGGAGRVRISDFYGKALNEGKWQFSESIDYLRQLGALDESDATNPRVIIPNYLSGPSNCVASSDYYSVCCLDECEGILGRLEEMVAAPEASPSTITRLISMIPSATM