Scaffold Ga0193374_1013920

Overview

Basic Information

• Taxon OID: 3300019105
• Scaffold ID: Ga0193374_1013920
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_122 - TARA_N000001942 (ERX1782301-ERR1712219)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 595
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: South Pacific Ocean: TARA_122
• Coordinates
  • Lat. (^o): -8.9948
  • Long. (^o): -139.2172
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019431	Metatranscriptome	229	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193374_10139201	F019431	GAG	MLALLILGAVASAQKPMPRWFVPSGPATKENCNAGGAEVFESPTSEIFVPEGKGTDICIFFAPPQPQEWLLGKGLSYNSKSCSEGCCFYTPASSKRVQEIEADVEKNLPTWFRAPAGGCDAVPSKTTTSRLILNKDNNDSGNEAALCVKSKDADTFVLLTGETTSCKGKCCVFNCKSCKA