Scaffold Ga0188835_1005587

Overview

Basic Information

• Taxon OID: 3300019096
• Scaffold ID: Ga0188835_1005587
• Source Dataset Name: Metatranscriptome of marine microbial communities from Baltic Sea - GS676_0p1
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1203
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Alteromonadales → Idiomarinaceae → unclassified Idiomarinaceae → Idiomarinaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location

• Location Name: Baltic Sea
• Coordinates
  • Lat. (^o): 62.09708
  • Long. (^o): 18.5427
  • Depth (m): 10

Associated Families

Family	Category	Number of Sequences	3D Structure?
F094945	Metagenome / Metatranscriptome	105	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0188835_10055874	F094945	GGAGG	VKPAIERGEKCYNARLTEEQVRLARIYVMQGPVGVLPQLARKWGVGQQTLRNAVIYKNWKHIPPPTAEEIAATPLPGWVETVGRETQRAHCGRCVHWDHSRGCTMGIPESGNGGFFAASCAAYATTSLAH