Scaffold Ga0188854_1004165

Overview

Basic Information

• Taxon OID: 3300019083
• Scaffold ID: Ga0188854_1004165
• Source Dataset Name: Metatranscriptome of marine microbial communities from Baltic Sea - GS680_3p0_dT
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 771
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Cryptophyceae → Pyrenomonadales → Geminigeraceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location

• Location Name: Baltic Sea
• Coordinates
  • Lat. (^o): 56.1664
  • Long. (^o): 16.378218
  • Depth (m): 4

Associated Families

Family	Category	Number of Sequences	3D Structure?
F048352	Metatranscriptome	148	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0188854_10041651	F048352	N/A	MMYTQLVTPVPAEQPKSRFNSRQVLAAACIVALGLCAVLFAVGEQAGEEDSVRNLLLATKASTSQLAAIKHKVMQMSPKQQMLYDSGMEDEAHKAMHIAYQTFMKAKDEGVLTEYDDLNATITEEQDALVDYADEMAAIQLEVENEEKEHAAQYDPQLPSE