Scaffold Ga0193459_101746

Overview

Basic Information

• Taxon OID: 3300019067
• Scaffold ID: Ga0193459_101746
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_132 - TARA_N000002412 (ERX1782229-ERR1712040)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 733
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Tunicata → Appendicularia → Copelata → Oikopleuridae → Oikopleura → Oikopleura dioica (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: North Pacific Ocean: TARA_132
• Coordinates
  • Lat. (^o): 31.4868
  • Long. (^o): -159.0749
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009309	Metagenome / Metatranscriptome	319	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193459_1017461	F009309	N/A	LSITATVQQLSVVGPGTTASSVTVQSFEWESVWVSTATGFFSGDTFDTWFDWASFVVAWVESVVVSISVVVDLGSGEKKSEQRVNKLSFDGTSVSGAVVGVQTVARFSQVDTGTGTWSVADFPWDARFAGSFGIDDSALVSVSQSFTESVNFVDWGTFTSSNVVIKVTPASVFVQRVDGVGNVTGKSSEGAVSDKTEKLS