Scaffold Ga0193208_10166876

Overview

Basic Information

• Taxon OID: 3300019055
• Scaffold ID: Ga0193208_10166876
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000073 (ERX1782414-ERR1711963)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1073
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Indian Ocean: TARA_041
• Coordinates
  • Lat. (^o): 14.6059
  • Long. (^o): 69.9776
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016981	Metagenome / Metatranscriptome	243	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193208_101668762	F016981	AGGA	MKNKTIDLSQFMLDENDEKLMKSLDSKTVKDDPNYSKNKRVNLEYYNQDELEDIGVDDYSDCDGREEIETLSDAGMDIY