Scaffold Ga0192981_10154409

Overview

Basic Information

• Taxon OID: 3300019048
• Scaffold ID: Ga0192981_10154409
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 906
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Atlantic Ocean: TARA_085
• Coordinates
  • Lat. (^o): -62.2231
  • Long. (^o): -49.2139
  • Depth (m): 90

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103312	Metagenome / Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0192981_101544091	F103312	N/A	VVLALDLSISDKTETGKDKTLDGYKCNRRHEYMRMGSEHVGFLGELDLSEFLSLGHHVLILNSHNTTTPGSSEGDVVVEASGEGALEVGEVSKVFLSDIGEGDAGSGLGVAELSESCFTSDEAEWDVVLSAESWQENHDLEWVNIVSHDDELGFAFLDESGDVVETVFKVEWLWSGVSGGGTLSGFSFSDESVFLLLSGLWGVLGEELEELGGLVLVNGLLELVESWW