Scaffold Ga0193336_10356734

Overview

Basic Information

• Taxon OID: 3300019045
• Scaffold ID: Ga0193336_10356734
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 665
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: South Pacific Ocean: TARA_110
• Coordinates
  • Lat. (^o): -1.9002
  • Long. (^o): -84.6265
  • Depth (m): 50

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055666	Metatranscriptome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193336_103567341	F055666	N/A	VDGLHGPARGWIGCAQFIHWATAHVASKVTGAVVESVDFNHVTNYSKQDFLQAVRTAINDPTSTDHANFYEFLLTIFVEEDHECKGVVNKAGFSRLVDRAAHVPRYFGLAPPSADPTRLAELYDAMEDPRLGGVTFRKFLEWTTQHTKGKIEAYKA