NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0192857_10289946

Scaffold Ga0192857_10289946


Overview

Basic Information
Taxon OID3300019040 Open in IMG/M
Scaffold IDGa0192857_10289946 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_065 - TARA_N000000963 (ERX1782167-ERR1712154)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterCanada's Michael Smith Genome Sciences Centre
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)556
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameIndian Ocean: TARA_065
CoordinatesLat. (o)-35.1728Long. (o)26.2868Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F012678Metagenome / Metatranscriptome278Y

Sequences

Protein IDFamilyRBSSequence
Ga0192857_102899461F012678GAGMRNPNSIQEVAEIHSLLTDIKKEYTEGIRSILQKNDPELFQNVHTIPKLKKIQINRGLGLAAQNTNILKK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.