NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193516_10299177

Scaffold Ga0193516_10299177


Overview

Basic Information
Taxon OID3300019031 Open in IMG/M
Scaffold IDGa0193516_10299177 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterCanada's Michael Smith Genome Sciences Centre
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)516
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameGulf of Mexico: TARA_142
CoordinatesLat. (o)25.6168Long. (o)-88.4532Alt. (m)Depth (m)125
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047430Metagenome / Metatranscriptome149Y

Sequences

Protein IDFamilyRBSSequence
Ga0193516_102991771F047430N/AYETHFAGGPRRNTRREFMGLRRTLGDDGERCLDITSRTDFVAPVKEPDRPKQSLVRVDTFKHTKNPRPTEAPQDGSMWSTHKRHPDEHGQRYFDTTTQTEMDSGLRTRDDLVLPPVGEGQGEVCRGGHEKAITNFHVFPFGHAKNNFYCTPGNRTVFNRSSSQISKGTASP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.