Scaffold Ga0193449_10262283

Overview

Basic Information

• Taxon OID: 3300019028
• Scaffold ID: Ga0193449_10262283
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002364 (ERX1789432-ERR1719419)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 737
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Rhizaria → Retaria → Foraminifera (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: North Pacific Ocean: TARA_131
• Coordinates
  • Lat. (^o): 22.7511
  • Long. (^o): -157.9632
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012645	Metatranscriptome	278	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193449_102622831	F012645	N/A	MSGKWGVVNPSWTKELIRCAFNRGYGQPIITGKHTGVWERTSRVAFYARRWDFDFLKIVAMRVDAARTPLCVLRRQIWMARMEYWLRKVGSFKSMYRAGKVEWAFIKGRLGQPMTWTGREVGHFCFWGVQCFAAFVFGEMLGRRDEFGYDVGVGVDWTPARPQFAPGFFHVHGVFDDYPFEKHTSMVGRKFQRGYWPNADDNYFYTPSGGPHVAPLVPVY