Basic Information | |
---|---|
Taxon OID | 3300019025 Open in IMG/M |
Scaffold ID | Ga0193545_10010785 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_151 - TARA_B100001565 (ERX1399745-ERR1328126) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1625 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (80.00%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | North Atlantic Ocean: TARA_151 | |||||||
Coordinates | Lat. (o) | 36.1715 | Long. (o) | -29.023 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001478 | Metagenome / Metatranscriptome | 687 | Y |
F031514 | Metagenome / Metatranscriptome | 182 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0193545_100107853 | F031514 | AGAAGG | LNEKFGLYVERPFYIVSNMDSHKYLDLINNRNMVVKTRNGRNTQVWWFDQRSLTIKTKLNNQSFDITSSGRSNNMQIWSTNSNWW |
Ga0193545_100107855 | F001478 | GGTGG | MDGEFLVNLKDSRVLDVQSNLDQENRNLIVHKRHGGLNQQWDVVYVDEWKGEPKKGELNEEFGLYVERPFHIVSALKDGRYLDLINNRNMVIKTANARNTQVWYFDQRSLTIKTKLNNQSFDITSSGRSNNMQVWSTNSNWW |
⦗Top⦘ |