| Basic Information | |
|---|---|
| Taxon OID | 3300018983 Open in IMG/M |
| Scaffold ID | Ga0193017_10239829 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000002997 (ERX1782408-ERR1712000) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 559 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | North Pacific Ocean: TARA_138 | |||||||
| Coordinates | Lat. (o) | 6.3559 | Long. (o) | -103.0598 | Alt. (m) | Depth (m) | 450 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F002308 | Metatranscriptome | 572 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0193017_102398291 | F002308 | AGG | MFHCVLVLLLVISTVTADTETVKSSVKVGKKKFSCTFSLANDGAGLVLGDSSVNCTPNKPTKKKVNNFKVSTDKADYTLTVNINPDKLVKGSMEMKEVKTAECAPGFTRVCPSGAGGSCPEGMFSFCPYNSSPAGTADTWACSCLQTRMLEIDIQAGTNPLGECHGECVCMSGD |
| ⦗Top⦘ |