Scaffold Ga0192961_10083560

Overview

Basic Information

• Taxon OID: 3300018980
• Scaffold ID: Ga0192961_10083560
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 958
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Archaea → Euryarchaeota → unclassified Euryarchaeota → Euryarchaeota archaeon (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Atlantic Ocean: TARA_083
• Coordinates
  • Lat. (^o): -54.3739
  • Long. (^o): -65.1342
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F033444	Metagenome / Metatranscriptome	177	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0192961_100835602	F033444	GGA	MDIKKIFTWVPIMAAVLGTLYTGINTIIRLNNTIEQHTLQLREMSTTISAIDERFSIEVKNLNRAYTEGREEVFREMTNARTELATARAKVEALNDSYYKMSNSVEDLKYDLKDFKREVTGDY