Scaffold Ga0193487_10205151

Overview

Basic Information

• Taxon OID: 3300018978
• Scaffold ID: Ga0193487_10205151
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_136 - TARA_N000002965 (ERX1789639-ERR1719422)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 648
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: North Pacific Ocean: TARA_136
• Coordinates
  • Lat. (^o): 17.0552
  • Long. (^o): -118.9008
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069654	Metatranscriptome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193487_102051511	F069654	N/A	QMVTVCQPGHHGYGGYGHGGYGHNYCKEVAQETAYNAPVVTPVDIPVTVAYPAPEKTCVDKPISLPVVQCNTLEEERTILVPTVQDSEVVVAKCTAGLGAPACQKVELTLPKQVCVELVYGYAHEPAPAYPAAHPAPAKAE