Scaffold Ga0193559_10255181

Overview

Basic Information

• Taxon OID: 3300018971
• Scaffold ID: Ga0193559_10255181
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_143 - TARA_N000003148
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 538
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: North Atlantic Ocean: TARA_143
• Coordinates
  • Lat. (^o): 29.8253
  • Long. (^o): -79.6833
  • Depth (m): 40

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074210	Metatranscriptome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193559_102551811	F074210	GGA	MIKLPKTVPIPAPDPATPTVAAPAPMNLAAASISREGAVVCNEEVGTKAVEVGRTTGLAIICGLIDTRAAFLNIGRAVLDKLYIMMTGWFWLGE