Scaffold Ga0193531_10033354

Overview

Basic Information

• Taxon OID: 3300018961
• Scaffold ID: Ga0193531_10033354
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002783 (ERX1789414-ERR1719458)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1800
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Nematocera → Culicomorpha → Culicoidea → Culicidae → Anophelinae → Anopheles → Anopheles → Angusticorn → Anopheles (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: North Atlantic Ocean: TARA_152
• Coordinates
  • Lat. (^o): 43.7421
  • Long. (^o): -16.9002
  • Depth (m): 25

Associated Families

Family	Category	Number of Sequences	3D Structure?
F038971	Metatranscriptome	164	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0193531_100333542	F038971	AGGAG	MNAAVGEIKKLNESLSQLRQENIVLKEETLRLKRIAAASEKPHDTPSYSSTTVTAVGPQTEVLPTTHIYAALIILVLGVMLGKFFL