NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193528_10177420

Scaffold Ga0193528_10177420


Overview

Basic Information
Taxon OID3300018957 Open in IMG/M
Scaffold IDGa0193528_10177420 Open in IMG/M
Source Dataset NameMetatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_151 - TARA_N000002755 (ERX1782215-ERR1712088)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterCanada's Michael Smith Genome Sciences Centre
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)777
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location NameNorth Atlantic Ocean: TARA_151
CoordinatesLat. (o)36.1736Long. (o)-29.003Alt. (m)Depth (m)80
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F013606Metatranscriptome269N

Sequences

Protein IDFamilyRBSSequence
Ga0193528_101774201F013606GAGMHSSSLRGFGTFDSYEGCRGLYPATSRLQSVPPRFYDIVDGESGRVLASDLTSGTTRARSMIRQSRLAEERAWPQPLYGDMVIGPTASAGHYSVPRTSGEFSRDIISRSRSPSPCPDAINMMNRDMIDSVNEKLHLSNMRNRFPETYRGQSSTYNPSLGRCQTSYDSPGFRYYRYDNHQEGPRISHSRVNQHMPRFSTRCRERVSVPPICPDISALTRRVKAH

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.