Basic Information | |
---|---|
Taxon OID | 3300018954 Open in IMG/M |
Scaffold ID | Ga0193590_1000339 Open in IMG/M |
Source Dataset Name | Soil crust microbial communities from Colorado Plateau, Utah, USA - early stage, 3 min after wetting v1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | QB3 Vincent J. Coates Genomics Sequencing Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 32121 |
Total Scaffold Genes | 34 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 23 (67.65%) |
Novel Protein Genes | 2 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Associated Families | 2 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Cyanophyceae | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Biological Soil Crust Microbial Communities From Moab Desert, Utah To Study Responses To Pulsed Climate Events |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: Utah, Colorado Plateau, Green Butte Site | |||||||
Coordinates | Lat. (o) | 38.712053 | Long. (o) | -109.695097 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F074217 | Metagenome | 119 | Y |
F094635 | Metagenome | 105 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0193590_100033912 | F094635 | AGGAG | MALGSKSSTNGHRTSNHSPGSDAATGISRAVVLILTTPARLINWLTTPPGNAIMIGLGVLYFGSVSAEGYWQAMNPNNPAFVPKPFVSDGADLRFIFTALIAPSFWMAAVVSLIVQGIQAFVLREMDIAKAQAEYQAVKDYRVPSPEEGQLDLAEYRRRRFKSVGMRTVRTRGALIALTYAIDAGIAFWNYPVIGQSTGEMIINLVWILASIFGTEAMINLFFNAIAPIKPQVEVLPN |
Ga0193590_10003398 | F074217 | AGGAG | MPDEIQLTQKQQLLMDFLNELATTPLTPETLAQGNQLLDAAADECRDLQQSIKQQTEVVD |
⦗Top⦘ |