Scaffold Ga0192852_10226448

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0192852_10226448

Scaffold Ga0192852_10226448

Overview

Basic Information
Taxon OID	3300018952 Open in IMG/M
Scaffold ID	Ga0192852_10226448 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_064 - TARA_N000000539 (ERX1782281-ERR1712142)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Canada's Michael Smith Genome Sciences Centre
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	602
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	Indian Ocean: TARA_064
Coordinates	Lat. (^o)	-29.5018	Long. (^o)	37.9887	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F085094	Metatranscriptome	111	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0192852_102264481	F085094	N/A	LTPWGRIAKYQTYPIAKQIQKSPLSKYLLWAGFFVALPMFNKLYNICNSPAALEGWKERRKEYYEPHHVKW

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.