| Basic Information | |
|---|---|
| Taxon OID | 3300018933 Open in IMG/M |
| Scaffold ID | Ga0193614_1159449 Open in IMG/M |
| Source Dataset Name | Soil crust microbial communities from Colorado Plateau, Utah, USA - earlymid stage, 42 hrs v1 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | QB3 Vincent J. Coates Genomics Sequencing Laboratory |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 616 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter xylanophilus | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Sand → Desert → Soil → Biological Soil Crust Microbial Communities From Moab Desert, Utah To Study Responses To Pulsed Climate Events |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Utah, Colorado Plateau, Green Butte Site | |||||||
| Coordinates | Lat. (o) | 38.712053 | Long. (o) | -109.695097 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F070963 | Metagenome | 122 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0193614_11594491 | F070963 | AGGAG | MLFHVTWEVFENIVLPEVRSVRNEWTGPQMQKVMESGKVREAGLFSGKRGGFFLVDIDAPEDLYKLFGPEFYDVGRIDAQPVTPIETAGEIFGQWAQEGR |
| ⦗Top⦘ |