NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0190273_10874749

Scaffold Ga0190273_10874749


Overview

Basic Information
Taxon OID3300018920 Open in IMG/M
Scaffold IDGa0190273_10874749 Open in IMG/M
Source Dataset NamePopulus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)724
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States

Source Dataset Sampling Location
Location NameUSA: Wyoming
CoordinatesLat. (o)44.4668Long. (o)-109.6253Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F035916Metagenome / Metatranscriptome171Y

Sequences

Protein IDFamilyRBSSequence
Ga0190273_108747492F035916GAGMGFGVLFLLLLVTAGWWLHSRWSALRDARAARREAEMLYVFEARSHAGARRAEAPAATPEATDFFPTLPGKG

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.