| Basic Information | |
|---|---|
| Taxon OID | 3300018920 Open in IMG/M |
| Scaffold ID | Ga0190273_10174824 Open in IMG/M |
| Source Dataset Name | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1313 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Nakamurellales → Nakamurellaceae → Nakamurella → unclassified Nakamurella → Nakamurella sp. PAMC28650 | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil → Populus Soil Microbial Communities From Riparian Zone Of Different River Systems In The Western United States |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | USA: Wyoming | |||||||
| Coordinates | Lat. (o) | 44.4668 | Long. (o) | -109.6253 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F047997 | Metagenome | 149 | Y |
| F051569 | Metagenome | 144 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0190273_101748241 | F051569 | N/A | NPEERIGMVRTFITTAPASVATGAASANTVYLAGPLDQINAWVAQWGTSLQILGGTILAICMVLVGIKLGTKAVVSNGGANTGNREAVGAIFTLLVAGILVGAALIIVPIFVGVGSSSGSTPAPVAPAPAPTEGG |
| Ga0190273_101748242 | F047997 | AGGGGG | LSSNDDQVIYSDDYTKLFTYQSRQFTAGDISLKAINGVQWNAAIPAAAAGVTVTTVFAVMLWVLGFSPWWSALILPVPTLIVYVRMAKDRAGGLTESEKIRLAWNYRYRQPRELLGLGENAEPTDFTWDVIFWEPSARTRTVGAAP |
| ⦗Top⦘ |