Scaffold Ga0193591_1181661

Overview

Basic Information

• Taxon OID: 3300018915
• Scaffold ID: Ga0193591_1181661
• Source Dataset Name: Soil crust microbial communities from Colorado Plateau, Utah, USA - late stage, 0 min after wetting v1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: QB3 Vincent J. Coates Genomics Sequencing Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 604
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → environmental samples → uncultured Rubrobacteraceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Sand → Desert → Soil → Biological Soil Crust Microbial Communities From Moab Desert, Utah To Study Responses To Pulsed Climate Events

Source Dataset Sampling Location

• Location Name: USA: Utah, Colorado Plateau, Green Butte Site
• Coordinates
  • Lat. (^o): 38.712053
  • Long. (^o): -109.695097

Associated Families

Family	Category	Number of Sequences	3D Structure?
F055430	Metagenome / Metatranscriptome	138	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193591_11816612	F055430	GGAGG	MDPKRGNLHQLSDAQRVQLVDTLEPIIAEILDIRAEEHPISFGDILLRKVGERYELSVNFWPKDD