Scaffold Ga0193598_1018211

Overview

Basic Information

• Taxon OID: 3300018910
• Scaffold ID: Ga0193598_1018211
• Source Dataset Name: Soil crust microbial communities from Colorado Plateau, Utah, USA - earlymid stage, 18 hrs after wetting v1
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: QB3 Vincent J. Coates Genomics Sequencing Laboratory
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1874
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Sand → Desert → Soil → Biological Soil Crust Microbial Communities From Moab Desert, Utah To Study Responses To Pulsed Climate Events

Source Dataset Sampling Location

• Location Name: USA: Utah, Colorado Plateau, Green Butte Site
• Coordinates
  • Lat. (^o): 38.712053
  • Long. (^o): -109.695097

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000756	Metagenome / Metatranscriptome	905	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193598_10182111	F000756	AGGAGG	MMDRERPAAPQGGPIPEAWIGQEVMIETTEVLSSDLRASAPVYLEDVNERGIVMMVTRHRDQNQFSRYFYPWGVVGWIRL