| Basic Information | |
|---|---|
| Taxon OID | 3300018903 Open in IMG/M |
| Scaffold ID | Ga0193244_1064437 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_080 - TARA_N000001499 (ERX1789636-ERR1719512) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 677 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Atlantic Ocean: TARA_080 | |||||||
| Coordinates | Lat. (o) | -40.6297 | Long. (o) | -52.0503 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F064363 | Metatranscriptome | 128 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0193244_10644371 | F064363 | N/A | LTRLEQRCLQLHSFLQAAQATMRRAQEQASSTFCDVAGQLCQEMVAQLATEHTKETKRLFDEVMLLRTEMENVRELLQGYLGREKVLSEMMQSMQMSFQDSRALMEGIHGQFASHVDDALGHHLQQKELMGDPIQDAQEEVQRINVVLSQPAVPPPDVPQHLHQVLKKDGRMV |
| ⦗Top⦘ |