NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0193610_1000262

Scaffold Ga0193610_1000262


Overview

Basic Information
Taxon OID3300018891 Open in IMG/M
Scaffold IDGa0193610_1000262 Open in IMG/M
Source Dataset NameSoil crust microbial communities from Colorado Plateau, Utah, USA - early stage, 18 hrs after wetting v1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterQB3 Vincent J. Coates Genomics Sequencing Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)20200
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)14 (66.67%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Desert → Soil → Biological Soil Crust Microbial Communities From Moab Desert, Utah To Study Responses To Pulsed Climate Events

Source Dataset Sampling Location
Location NameUSA: Utah, Colorado Plateau, Green Butte Site
CoordinatesLat. (o)38.712053Long. (o)-109.695097Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F017778Metagenome / Metatranscriptome238Y
F038520Metagenome / Metatranscriptome165Y
F044877Metagenome / Metatranscriptome153N

Sequences

Protein IDFamilyRBSSequence
Ga0193610_100026210F044877GGAGMTFTEGCPSGRSQDLTCVSEEMVTLDRKTLEEIFSLIGDCVDTIINLRHSGVFITSAKRCLLDTGNLELASSTEVSEAALLLDTWLDVVPKSHKEMDAWLQQANAITYLALAPIKLGKSN
Ga0193610_100026215F017778N/AMAKGKTKGKRGGTRPGAGNPYKWKHRETKPVRLPIALIPKILEIAQLIDGQEYIDRVQHEFDDEEGKPKYYNGYYAAQLSYLRTGNDALAEEVNKLRIENEALKAQLRELNNGILPEPNPDFSSLLLVPKPKPLAKQNRRKKRKDIIFVE
Ga0193610_100026220F044877GGAGMTFTEGCPPGRSQDLTCVPEEMVTLDRKTLEEIFSLIGDCVDTIINLRHSGVFITSAKRCLLDTGNLELASSTEVSEAALLLDTWLDVVPKSHKEMDTWLQQANAITYLALAPIKLGKSN
Ga0193610_10002625F038520N/AMKHPKIKHGGSRAGAGRPHKYRGGETKLVRIPVAYVDKILRVVAYMDANEGQLPQGIAFATEGDDFSCPGYDASRELPYPDFDGYNKRHRNSTFGENFHK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.