Basic Information | |
---|---|
Taxon OID | 3300018878 Open in IMG/M |
Scaffold ID | Ga0187910_12505736 Open in IMG/M |
Source Dataset Name | Goat fecal pellet fungal communities from Santa Barbara, California, USA ? diluted pellet 1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 514 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Goat Feces → Determining The Genomic Basis For Interactions Between Gut Fungi And Methanogenic Archaea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 34.4204 | Long. (o) | -119.6671 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F059514 | Metagenome | 133 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0187910_125057361 | F059514 | GAG | MHLVLTPVVFDLRLNTAIFACFAGKNCKFRASKKPTVGFFAQ |
⦗Top⦘ |