Basic Information | |
---|---|
Taxon OID | 3300018874 Open in IMG/M |
Scaffold ID | Ga0192977_1028206 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1102 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Tintinnida → Xystonellidae → Favella → Favella ehrenbergii | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Ocean: TARA_085 | |||||||
Coordinates | Lat. (o) | -62.0385 | Long. (o) | -49.529 | Alt. (m) | Depth (m) | 5 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F082761 | Metagenome / Metatranscriptome | 113 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0192977_10282061 | F082761 | GGA | LGVDNLEDSDESIGETGVEGLLVLGPDEGSATDEGGSSVLTVKGGGFVSVDEFLVWEIVDLDTLFGTNDEPVKFGGEQDNVNWGFGINLFEMSSFNQVPDVDFTVSTTGSDEVGVWCKIKGVDLSFVSNESVFQGHDGVIPNLDGLIPRSRNDDWFLDIVEISDAGNPVSMLVLVNGEFADTVDVPNLEVLIDGTGGDLSVIWGESNREDIFGVTNKSLSGLSSLEVPESDGTIP |
⦗Top⦘ |