Scaffold Ga0193553_1019548

Overview

Basic Information

• Taxon OID: 3300018873
• Scaffold ID: Ga0193553_1019548
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001098
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1735
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: South Pacific Ocean: TARA_093
• Coordinates
  • Lat. (^o): -33.9116
  • Long. (^o): -73.0537
  • Depth (m): 35

Associated Families

Family	Category	Number of Sequences	3D Structure?
F004175	Metagenome / Metatranscriptome	449	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193553_10195481	F004175	AGTAG	VTLACKDANLKLVEVVTVADVDAEDHVGNSLLQIWELTFAPKANLLFRL