Scaffold Ga0193214_1037157

Overview

Basic Information

• Taxon OID: 3300018854
• Scaffold ID: Ga0193214_1037157
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_041 - TARA_N000000076 (ERX1789602-ERR1719346)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 949
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Hymenoptera → Apocrita → Parasitoida → Chalcidoidea → Trichogrammatidae → Trichogramma → Trichogramma brassicae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Indian Ocean: TARA_041
• Coordinates
  • Lat. (^o): 14.6067
  • Long. (^o): 69.9775
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F013605	Metatranscriptome	269	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193214_10371572	F013605	N/A	RTDKTIWRTVLQPQEVTVVDSEEGLVTVVGEDVAEAADVVAGEEGEDVTRRRRTGSP