Scaffold Ga0193048_1051022

Overview

Basic Information

• Taxon OID: 3300018825
• Scaffold ID: Ga0193048_1051022
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 627
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Atlantic Ocean: TARA_081
• Coordinates
  • Lat. (^o): -44.5342
  • Long. (^o): -52.455
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030777	Metagenome / Metatranscriptome	184	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193048_10510221	F030777	AGGA	MDAAAIKAYSSVIADAAEDSEPQTPVQYSAVIPDEEKKAPVQSLSQDPMGSMIQNEISEIKDASIKASKEEXKSNEC