Scaffold Ga0193117_1052783

Overview

Basic Information

• Taxon OID: 3300018796
• Scaffold ID: Ga0193117_1052783
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_004 - TARA_X000000410 (ERX1789505-ERR1719432)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 681
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: North Atlantic Ocean: TARA_004
• Coordinates
  • Lat. (^o): 36.5533
  • Long. (^o): -6.5669
  • Depth (m): 40

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058667	Metatranscriptome	134	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0193117_10527832	F058667	N/A	LAMHSSFVTMIALVAAFASFSCSNSLATLHHEQIVLDLASINRSQLQEANSSMESLLSLQNETNESSVQLASAWGIPNHPIRRAMVCHAVFGPGHRFLRRACWLSGFVQTSAGMNNSNASLDMSELDEVDKSLGYSVSNASNASEELTSQWGIPHHPIARAMVCHAVFGPNHRFLRRACWWSGR