Scaffold Ga0193149_1046454

Overview

Basic Information

• Taxon OID: 3300018779
• Scaffold ID: Ga0193149_1046454
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 618
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Mediterranean Sea: TARA_022
• Coordinates
  • Lat. (^o): 39.5705
  • Long. (^o): 17.4101
  • Depth (m): 30

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051103	Metatranscriptome	144	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193149_10464541	F051103	N/A	MRCILAAVLVASVLGANPEEELDKLALHVEHYPHAQGSNHAIYQFQIDNNNENDKATDPVDFTAEVSPDMDVTNAYFFREKTGATPQKESCKVGQRSPASREKINKKFPGAKITFPKIVKCKISHIDEFATIYVHASVPEHKELPLNEIVKASYSQRGTHGDSIEIPAIDSSQVSF