Basic Information | |
---|---|
Taxon OID | 3300018775 Open in IMG/M |
Scaffold ID | Ga0188848_1020495 Open in IMG/M |
Source Dataset Name | Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8 |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 707 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Baltic Sea | |||||||
Coordinates | Lat. (o) | 56.1664 | Long. (o) | 16.378218 | Alt. (m) | Depth (m) | .3 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F097242 | Metagenome / Metatranscriptome | 104 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0188848_10204951 | F097242 | AGGAG | VKKKLYSINPEGLALLKTLVDPLSPFYIDAVMSLEQAMEVEDMPHFEGTIFGAEHFDEVVVGGW |
⦗Top⦘ |