Scaffold Ga0188848_1016705

Overview

Basic Information

• Taxon OID: 3300018775
• Scaffold ID: Ga0188848_1016705
• Source Dataset Name: Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 791
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location

• Location Name: Baltic Sea
• Coordinates
  • Lat. (^o): 56.1664
  • Long. (^o): 16.378218
  • Depth (m): .3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F014683	Metagenome / Metatranscriptome	261	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0188848_10167052	F014683	AGGAG	MAEEAKRKFTYTLTIECAGEGKADLEAVESILDLHFQELVMDDTFVGHLDEQQAVTIQVIPHFGQK