Scaffold Ga0188848_1008733

Overview

Basic Information

• Taxon OID: 3300018775
• Scaffold ID: Ga0188848_1008733
• Source Dataset Name: Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1115
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium TMED10 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location

• Location Name: Baltic Sea
• Coordinates
  • Lat. (^o): 56.1664
  • Long. (^o): 16.378218
  • Depth (m): .3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074737	Metagenome / Metatranscriptome	119	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0188848_10087332	F074737	N/A	MAKILQFPTKEKIQEKDSSEFLNKLSDECVDSSHFLLELLEEFINTGEVHEDFIDMDFRDETKQESRDMFVIVNMMNAMFHRWYDMPHGLHQTMDNAYIKVKEMILLNEEANHDLAEFVFEPEDSEFEFTFTPEEPEDNDTD