NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0188848_1000047

Scaffold Ga0188848_1000047


Overview

Basic Information
Taxon OID3300018775 Open in IMG/M
Scaffold IDGa0188848_1000047 Open in IMG/M
Source Dataset NameMetatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterJ. Craig Venter Institute (JCVI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)13814
Total Scaffold Genes33 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)27 (81.82%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location
Location NameBaltic Sea
CoordinatesLat. (o)56.1664Long. (o)16.378218Alt. (m)Depth (m).3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F103045Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0188848_10000477F103045AGGAMKFILIVMIGSWISPDRIEFDTLAECEMTAKKLTYGKIITACELGESNDGISESSDNTGGIL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.