Scaffold Ga0193031_1058827

Overview

Basic Information

• Taxon OID: 3300018765
• Scaffold ID: Ga0193031_1058827
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002803 (ERX1782330-ERR1712010)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 645
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: North Atlantic Ocean: TARA_152
• Coordinates
  • Lat. (^o): 43.7056
  • Long. (^o): -16.8794
  • Depth (m): 25

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076147	Metagenome / Metatranscriptome	118	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193031_10588272	F076147	N/A	MSQRSHSSSALSCSPLGLKRPVVASNFARWVAGRRASLLLLVPVLLATVATKRMRLVAAFSLSLSSLRHSVTHLINPHVL