Scaffold Ga0193416_1004999

Overview

Basic Information

• Taxon OID: 3300018748
• Scaffold ID: Ga0193416_1004999
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_125 - TARA_N000002025 (ERX1789516-ERR1719249)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1948
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Endopterygota → Diptera → Brachycera → Muscomorpha → Eremoneura → Cyclorrhapha → Schizophora → Calyptratae → Muscoidea → Muscidae → Muscinae → Stomoxyini → Haematobia → Haematobia irritans (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: South Pacific Ocean: TARA_125
• Coordinates
  • Lat. (^o): -8.892
  • Long. (^o): -142.6358
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F073052	Metatranscriptome	120	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0193416_10049994	F073052	N/A	MDKDVFLGVVPVDKPIAGLDVEPLDGAGDFGGNHLLGYLLHLLVSSSLLLVGLGLRVSHDGNVVLMVTNFSPRLFVRWRITS