Scaffold Ga0193425_1030022

Overview

Basic Information

• Taxon OID: 3300018743
• Scaffold ID: Ga0193425_1030022
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002293 (ERX1782423-ERR1712174)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 740
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: South Pacific Ocean: TARA_128
• Coordinates
  • Lat. (^o): 0.0078
  • Long. (^o): -153.6265
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063325	Metatranscriptome	129	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0193425_10300222	F063325	GAG	VSDRLFWESTVVMSELLANSMSSWTAGESSEWNNCSMSKDLIHVIDCSLQTQTFASASSLICRLEMSSQI