Scaffold Ga0193534_1051376

Overview

Basic Information

• Taxon OID: 3300018741
• Scaffold ID: Ga0193534_1051376
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002797 (ERX1789651-ERR1719275)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 625
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Crustacea → Multicrustacea → Hexanauplia → Copepoda → Neocopepoda → Podoplea → Harpacticoida → Harpacticidae → Tigriopus → Tigriopus californicus (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: North Atlantic Ocean: TARA_152
• Coordinates
  • Lat. (^o): 43.7056
  • Long. (^o): -16.8794
  • Depth (m): 25

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025753	Metagenome / Metatranscriptome	200	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193534_10513761	F025753	N/A	FGYIDKGTFFDDANIAGFPKMIEVVYQGFVWAMDIRYDSERIMHGGIHDILKDKVKREKVFLKDDYIVRISGRASPYNINRLTFYTAKGKTFGPWGDRRSKESVDFDVTAPPGHALAYFSGTVDFGVPFRSISFHWRPIPT