| Basic Information | |
|---|---|
| Taxon OID | 3300018729 Open in IMG/M |
| Scaffold ID | Ga0193174_1091900 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_036 - TARA_N000000313 (ERX1789694-ERR1719374) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 502 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Indian Ocean: TARA_036 | |||||||
| Coordinates | Lat. (o) | 20.8215 | Long. (o) | 63.512 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F072905 | Metatranscriptome | 120 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0193174_10919001 | F072905 | N/A | IAVMLGEVRSEKDIELHFALVHKKTRGLGIGSLCVSLLCSLSFQKAKRVLVGAEKMEVYNRSTRSYEVLHKEVSPVVRFWRREGFQEISERRFGDDEHDIFHFQMSKAMFEEKQVSIFGLTGSIQKAMSSRNFAKLFPPTARPRVPKIRLNAPWAGDFWVDCSAVAR |
| ⦗Top⦘ |