NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0194246_1052568

Scaffold Ga0194246_1052568


Overview

Basic Information
Taxon OID3300018726 Open in IMG/M
Scaffold IDGa0194246_1052568 Open in IMG/M
Source Dataset NameEukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000618 (ERX1782150-ERR1711887)
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterGenoscope
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)647
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059624Metatranscriptome133N

Sequences

Protein IDFamilyRBSSequence
Ga0194246_10525681F059624N/AHGDLLVTQPANMTRILLLSMVASGMAMSTRQEIQMDMEKFNNDAMCWGVENMMYYRLAQYQAMEECSKYGQFSTLPAPANNPFTTLPGDAKNPWMNVPQPVDSRRNPLAKLFNRNSNSNSDKWANLWSDFLNGRSKRQAEEGGLLEIDEAAELEKFLADYDEFKEDIGSMIGNLTCVMTKLDMLDSALQVNLKLWTTDVWQQLDLKKTLAGEDPE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.