Scaffold Ga0192904_1015001

Overview

Basic Information

• Taxon OID: 3300018721
• Scaffold ID: Ga0192904_1015001
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_070 - TARA_N000000666 (ERX1789483-ERR1719260)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1203
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: South Atlantic Ocean: TARA_070
• Coordinates
  • Lat. (^o): -20.4035
  • Long. (^o): -3.1859
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015958	Metatranscriptome	250	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0192904_10150011	F015958	N/A	LLHRYTGAVLPRHTSAALLGDLLALLLHYVVAVLLGNTTAVMLGYMLAVLQWDSAANLLWNLLAILAGNLTAILLRDLLALFPWNLLASFPRNLGATLPGNLATRFLGDLLAVLFRDLVARLPWNLLAALPWDFSAVLPRYLLTRLLGNL