 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300018707 Open in IMG/M |
| Scaffold ID | Ga0192876_1013023 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_067 - TARA_N000000746 (ERX1789613-ERR1719509) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1696 |
| Total Scaffold Genes | 1 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amphibia → Batrachia → Anura → Pipoidea → Pipidae → Xenopodinae → Xenopus → Silurana → Xenopus tropicalis | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | South Atlantic Ocean: TARA_067 | |||||||
| Coordinates | Lat. (o) | -32.1745 | Long. (o) | 17.6991 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005179 | Metatranscriptome | 409 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0192876_10130231 | F005179 | GAGG | VVRQSNWIRSSNMSRAAPSEASKYPPTEFSLKYTKVLAPDGKLETPEKLFGEGGRFDKDVAEKTKLAFKVTMKKLEKYNTASEFNKEHLVTAKVDQIVECFPNTLLKLLPNTIQKTKWSKKSKEVENWDIWWSMHGKILAPLQAQAEIIHKWWEFTGKPDPGVDEVTNGLKRLVTGVLTHPMTIGKAISAYTPKRKKDKPKSIHLIGTDTPEATMIYAGFYTEILSCNPLHPIKLTMVSPSQGNKQLSKDCGPNNPMLINDRCKLTAWDGLYHDFWERYITTQKVEVPDIVMSIHPHLEGEFWGPTVDMLLDENIVTCFTAFNEEHFKQALERLDYVFAKYIFKGVNPWVSGHVKQTPHDPNMIWASNQYMIVFKGRTVDMKTLTLIEEPTEEVLAEAEDEFERLLNEGN |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |