Scaffold Ga0193166_1007015

Overview

Basic Information

• Taxon OID: 3300018674
• Scaffold ID: Ga0193166_1007015
• Source Dataset Name: Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_026 - TARA_E400007200 (ERX1782187-ERR1712006)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: Canada's Michael Smith Genome Sciences Centre
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 782
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Dinophyceae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location

• Location Name: Mediterranean Sea: TARA_026
• Coordinates
  • Lat. (^o): 38.4761
  • Long. (^o): 20.1705
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074303	Metatranscriptome	119	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193166_10070151	F074303	GGA	MVARVEKTWRQLSSQKYKSILDLVSKKADHSVLRLLQISLQHIESQLDRVRHERELWKEVVDKRSQQPLQLALTLKDQHTGMPLGGQMGTAMTPMGQMQQFSSQPGSAEGARMSMGPPGSVQMQEPAMKQSPLAKRIAKPAGPPPKA