Scaffold Ga0193571_1019436

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0193571_1019436

Scaffold Ga0193571_1019436

Overview

Basic Information
Taxon OID	3300018671 Open in IMG/M
Scaffold ID	Ga0193571_1019436 Open in IMG/M
Source Dataset Name	Metatranscriptome of marine prokaryotic communities collected during Tara Oceans survey from station TARA_078 - TARA_B100000524
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	Canada's Michael Smith Genome Sciences Centre
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	534
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey

Source Dataset Sampling Location
Location Name	TARA_078
Coordinates	Lat. (^o)	-30.1885	Long. (^o)	-43.2831	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F009426	Metagenome / Metatranscriptome	318	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0193571_10194361	F009426	N/A	MAAAKVNKDLKLSLIMVKSEISYQLPVFKTTSPHVISVGPARETLYEGKADYCMIVCEYCLYIN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.