Scaffold Ga0188882_1020709

Overview

Basic Information

• Taxon OID: 3300018665
• Scaffold ID: Ga0188882_1020709
• Source Dataset Name: Metatranscriptome of marine microbial communities from Baltic Sea - LD30M_ls2
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 562
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Epsilonproteobacteria → Campylobacterales → Campylobacteraceae → Campylobacter → Campylobacter coli (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake → Metatranscriptome Of Marine Microbial Communities From Baltic Sea

Source Dataset Sampling Location

• Location Name: Baltic Sea
• Coordinates
  • Lat. (^o): 58.581234
  • Long. (^o): 18.232801
  • Depth (m): .3

Associated Families

Family	Category	Number of Sequences	3D Structure?
F031456	Metagenome / Metatranscriptome	182	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0188882_10207091	F031456	N/A	SSAVFNLDFLPEKFLIGTAGADNQSLSSFSVVTSGVQLMSITDVARLTALAKFDSGAILSDPTSPGYSTTASWLRLCTGRINKATTITGTNGTALNVDAFAASTNISNVARRAVEQSINPSANATFDNFEALIFDPTNVLRAQITFANGFTDEYTTGELRALYSNYHVADRSGNLEDLTVIDADSGA