| Basic Information | |
|---|---|
| Taxon OID | 3300018656 Open in IMG/M |
| Scaffold ID | Ga0193269_1007809 Open in IMG/M |
| Source Dataset Name | Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_093 - TARA_N000001292 (ERX1789469-ERR1719513) |
| Source Dataset Category | Metatranscriptome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Canada's Michael Smith Genome Sciences Centre |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1673 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| Not Available | (Source: ) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Viral And Eukaryotic Protist Communities Collected From Different Water Depths During Tara Oceans Survey |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Pacific Ocean: TARA_093 | |||||||
| Coordinates | Lat. (o) | -34.0614 | Long. (o) | -73.1066 | Alt. (m) | Depth (m) | 5 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F027068 | Metatranscriptome | 195 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0193269_10078091 | F027068 | AGG | VREVLSTKDKSMCNVIFETHPIARKAFTMQQQIRLRIVPPINSRRCWFRNPSPKFLVQFETKCRLTVRKGKAECHDTVGELLKGCFITVDQLKGNRIRVMCCEGSFMFPGGKIVEMKGVQDKSDKKTSLGWISFRCKDKLLVIRRSWNMLSDYVYKK |
| ⦗Top⦘ |